PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00020987001
Common NameGSBRNA2T00020987001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 362aa    MW: 39750.6 Da    PI: 7.7902
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00020987001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32160215156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00020987001 160 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 215
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.682157217IPR017930Myb domain
SuperFamilySSF466891.66E-17158218IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28158218IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-27160215IPR006447Myb domain, plants
PfamPF002492.8E-7162213IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
NKISVEVYRQ QLEAYRENSN NSNQSVVARP VLEEFIPLRN QPEKENNKGN NWMTTAQLWS  60
QPETKPKNID PTTDQSPKDE LASSPKLGHF DVKQRNGGGA FLPFSKEKTL PELALSTEVK  120
RVSPANEHTN DHDCNGESII NGSNNNNNNN SSTTSQSNRK ARRCWSPDLH RRFVQALQML  180
GGSQVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTRRPS PSPSPQTSSG QGPHLVVLGG  240
IWVPPEYTTA HGGTPTLYHH QVQNHQGNAA AQPPPHFCSS QEFYTARPPP QQLHHHHFQT  300
CNGSSADGSA STDSAHQLTD SAADDGKSLE SGGGERKGLA ALREESGNQS NINGSEITLK  360
F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687047.10.0PREDICTED: uncharacterized protein LOC106391028
TrEMBLA0A078JYW00.0A0A078JYW0_BRANA; BnaAnng39110D protein (Fragment)
STRINGBra026548.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-166G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]